General Information

  • ID:  hor002064
  • Uniprot ID:  P25289
  • Protein name:  Molluscan insulin-related peptide 2 A chain
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the cerebral light-green cells which are giant neuroendocrines cells involved in the control of growth.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  QRTTNLVCECCFNYCTPDVVRKYCY
  • Length:  25(113-137)
  • Propeptide:  MVGVRLVFTNAFVVTVLLTLLLDVVVKPAEGQSSCSLSSRPHPRGICGSNLAGFRAFICSNQNSPSMVKRDAETGWLLPETMVKRNAETDLDDPLRNIKLSSESALTYLTKRQRTTNLVCECCFNYCTPDVVRKYCY
  • Signal peptide:  MVGVRLVFTNAFVVTVLLTLLLDVVVKPAEG
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-P25289-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002064_AF2.pdbhor002064_ESM.pdb

Physical Information

Mass: 345076 Formula: C129H197N35O39S5
Absent amino acids: AGHIMSW Common amino acids: C
pI: 7.81 Basic residues: 3
Polar residues: 13 Hydrophobic residues: 5
Hydrophobicity: -25.2 Boman Index: -5145
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 50.4
Instability Index: 3118.8 Extinction Coefficient cystines: 4720
Absorbance 280nm: 196.67

Literature

  • PubMed ID:  1350761
  • Title:  Purification and Sequencing of Molluscan Insulin-Related Peptide II From the Neuroendocrine Light Green Cells in Lymnaea Stagnalis